{ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Je nach Qualität des Filmmaterials sind dafür schnelle Breitbandzugänge nötig. }, "event" : "approveMessage", Proiptv.de bittet mit Fernsehsendungen in HD Qualität. { "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:refresh_attachment_statuses","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#attachments_0_2cd3e03e73eb9c","action":"refresh_attachment_statuses","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.attachments_0:refresh_attachment_statuses?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276&t:cp=messages/contributions/messageviewparameterscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"0chyk0UgCqk44n0ig2Fze668-pwI9rCRdj_dkjSCvts. "actions" : [ var clickHandler = function(event) { "action" : "rerender" "entity" : "2059717", ] "event" : "kudoEntity", "event" : "addMessageUserEmailSubscription", }, "actions" : [ })(LITHIUM.jQuery); }, "includeRepliesModerationState" : "false", CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); { PREMIUM IPTV-PAKETE ... Senden Sie keine Testanfragen über das Kontaktformular. "event" : "RevokeSolutionAction", } "action" : "rerender" { element.children('ul').slideDown(); "forceSearchRequestParameterForBlurbBuilder" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", { } "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "pulsate" "context" : "", "actions" : [ "context" : "", "componentId" : "forums.widget.message-view", return; ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ;(function($) { { "displaySubject" : "true", Diese Tipps lösen in der Regel die Probleme: Diese Tipps lösen in … "event" : "ProductAnswer", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'Ve4ETiQ989PfJ5GPmft6wsuFvJW_8S8KKjOWPx16bR4. ] Hallo Ich habe keinen mir bekannten Sender gefunden, habe jetzt auch nur den digitalen. "actions" : [ "componentId" : "kudos.widget.button", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] var key = e.keyCode; "action" : "rerender" { { "action" : "rerender" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1582,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXB18PClJRBFMGCxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVTBgZQB1NSVBRXVlUDSQECBVRIVFQNAU8BAAFRVwcBBlJTXQtAThUPVn1bVgB\/AhsIQDFDC1BBQVwCRQtcXgYXWQNQXX1cEVMUV1cWNmEwUF9RVApYRBUQCQFlAUZHYgA0QwNLS0BYFTdwf3FxMRYPXRIkMHgpFV5RQRZXAVxBQjV\/IWd2FEYKRg9aHAsGClsVf31\/LGJGBhAfHw=="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ $(document).ready(function(){ if ( neededkeys[count] == key ) { }, "disableLabelLinks" : "false", { "actions" : [ "action" : "rerender" $(this).toggleClass("view-btn-open view-btn-close"); { "initiatorDataMatcher" : "data-lia-message-uid" "quiltName" : "ForumMessage", }); }, "event" : "ProductAnswerComment", { "context" : "envParam:quiltName,message,product,contextId,contextUrl", } Eine Frage haben? kein problem wenn er das ist was ich brauche. "context" : "", "action" : "rerender" 1.Open Pli auf die Box geflashed 2.in etc/enigma iptv Boquet kopiert 3.Neustart sehe leider nichts LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); }, }, "context" : "", }); } Wenn Ihr Fernseher keinen Sender findet, kann das je nach Anschluss verschiedene Gründe haben. } { "context" : "envParam:entity", { "kudosLinksDisabled" : "false", count = 0; } { "event" : "MessagesWidgetEditAnswerForm", ] { "revokeMode" : "true", "actions" : [ { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "actions" : [ var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "action" : "rerender" "actions" : [ }, { "action" : "rerender" "dialogKey" : "dialogKey" "action" : "rerender" Standardized Name defines channel's logo and EPG (if available), it also will be displayed in the app if the option Use custom channels' titles is turned off. "useTruncatedSubject" : "true", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { Anbietern. // Set start to true only if the first key in the sequence is pressed "actions" : [ "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "event" : "addMessageUserEmailSubscription", Für das IPTV benötigt man einen Receiver und einen Anbieter und bei diesem wiederum ein Abo. })(LITHIUM.jQuery); "actions" : [ return; "actions" : [ "event" : "kudoEntity", } Für das IPTV benötigt man einen Receiver und einen Anbieter und bei diesem wiederum ein Abo. "event" : "kudoEntity", }, "actions" : [ ] } "selector" : "#messageview_0", ] ] "displaySubject" : "true", "displaySubject" : "true", window.location.replace('/t5/user/userloginpage'); "event" : "addThreadUserEmailSubscription", ] { } (Tipp ursprünglich verfasst von: Marcel Peters ). "triggerEvent" : "click", event.preventDefault(); "actions" : [ { } element.removeClass('active'); "context" : "envParam:feedbackData", } "action" : "rerender" "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "}); { Alles weitere, was du über irgendeine m3u-Playlist angezeigt bekommst, ist so einfach nicht legal und auch das wird hier nicht supported. { "componentId" : "forums.widget.message-view", "event" : "MessagesWidgetEditAnswerForm", if ( key == neededkeys[0] ) { "action" : "rerender" "action" : "rerender" "initiatorBinding" : true, "context" : "", resetMenu(); "context" : "envParam:quiltName,product,contextId,contextUrl", //$('#vodafone-community-header').css('display','block'); "event" : "unapproveMessage", das „PVR IPTV Simple Client“ Addon. { ] "action" : "rerender" "context" : "", ] Gustav Fröhlich Hamburg, Deutschland. "action" : "rerender" "}); "context" : "envParam:entity", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); ], { } Watch IPTV from your Internet service provider or free live TV channels from any other source in the web. "action" : "pulsate" { }, //$('#community-menu-toggle').removeClass('active') }, }, { LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); }, "kudosLinksDisabled" : "false", "context" : "", ] { LITHIUM.MessageAttachments({"selectors":{"attachmentIconContainer":".lia-attachment-icon-container","attachmentLinkSelector":".lia-message-attachment-link-row-element"},"misc":{"attachmentHighlighter":"lia-highlight-attachment","showAttachmentDetails":false}}); { { "event" : "editProductMessage", V.I.P. "actions" : [ ] "event" : "markAsSpamWithoutRedirect", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_24","feedbackSelector":".InfoMessage"}); "context" : "", "disableLinks" : "false", "action" : "rerender" "useSimpleView" : "false", ;(function($) { "context" : "lia-deleted-state", "context" : "envParam:quiltName,message", '; }, "selector" : "#messageview_3", LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, } count = 0; "actions" : [ LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; } } "action" : "rerender" }); { "parameters" : { Lösung in ursprünglichem Beitrag anzeigen. lithstudio: [], "actions" : [ }, ] LITHIUM.AjaxSupport.ComponentEvents.set({ } { }(LITHIUM.jQuery)); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "linkDisabled" : "false" "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); "action" : "pulsate" IPTV HD Box mit 200 Türkishe, 40 Ku "event" : "addThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", count++; "event" : "kudoEntity", "actions" : [ "event" : "ProductAnswerComment", "event" : "kudoEntity", "event" : "approveMessage", "forceSearchRequestParameterForBlurbBuilder" : "false", { } { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); }, }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { }, } "event" : "ProductAnswerComment", ] "event" : "ProductAnswer", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "displayStyle" : "horizontal", "event" : "MessagesWidgetEditAction", "messageViewOptions" : "1111110111111111111110111110100101001101" { "event" : "deleteMessage", "context" : "lia-deleted-state", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_2cd3e022c9658c","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { "event" : "ProductAnswerComment", ( gelöst ) Kein Ton bei IPTV-Streams. "action" : "rerender" ], "actions" : [ "event" : "approveMessage", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "floatedBlock" : "acceptedSolutions", "event" : "expandMessage", "showCountOnly" : "false", }, "action" : "pulsate" } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); }, "action" : "rerender" "actions" : [ "componentId" : "forums.widget.message-view", Buschi. } })(LITHIUM.jQuery); { { "context" : "", "context" : "", "disallowZeroCount" : "false", "context" : "lia-deleted-state", } } LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); ] { "actions" : [ "actions" : [ "action" : "pulsate" "buttonDialogCloseAlt" : "Schließen", "truncateBody" : "true", "displaySubject" : "true", } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, watching = true; return; "context" : "", })(LITHIUM.jQuery); } ] var key = e.keyCode; "event" : "MessagesWidgetMessageEdit", "action" : "pulsate" { "context" : "", VLC media player nutzen. ] "event" : "AcceptSolutionAction", } }, "entity" : "2053068", "event" : "QuickReply", } "action" : "rerender" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1582,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXB18PClJRBFMGCxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVTBgZQB1NSVBRXVlUDSQECBVRIVFQNAU8BAAFRVwcBBlJTXQtAThUPVn1bVgB\/AhsIQDFDC1BBQVwCRQtcXgYXWQNQXX1cEVMUV1cWNmEwUF9RVApYRBUQCQFlAUZHYgA0QwNLS0BYFTdwf3FxMRYPXRIkMHgpFV5RQRZXAVxBQjV\/IWd2FEYKRg9aHAsGClsVf31\/LGJGBhAfHw=="}. } else { Wenn ein in deinem Abonnement enthaltener Sender nicht freigeschalten ist, bitte den Kundenservice von Sky unter 089 99 72 79 00 (Montag bis Sonntag 8 - 22 Uhr) kontaktieren. Wir haben einige der beliebtesten Videoportale miteinander verglichen. { }, var key = e.keyCode; LITHIUM.AjaxSupport.ComponentEvents.set({ { "action" : "pulsate" $(document).ready(function(){ "actions" : [ "actions" : [ Der VLC Media Player spielt IPTV direkt am PC ab. { } "actions" : [ 2,764. LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); "actions" : [ LITHIUM.StarRating('#any_0_2', true, 2, 'LITHIUM:starRating'); "context" : "envParam:selectedMessage", "action" : "rerender" }, } "actions" : [ // --> LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276","ajaxErrorEventName":"LITHIUM:ajaxError","token":"t0evgQXqgQxo0MPLnmrDGReK0QoHUUmPLi_28fIdJDI. { //$('#lia-body').removeClass('lia-window-scroll'); } "context" : "envParam:quiltName,message", M3U inputstreamaddon and inputstreamclass to be deprecated in favour of inputstream . "disableLinks" : "false", { { "initiatorBinding" : true, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); LITHIUM.Auth.CHECK_SESSION_TOKEN = 'IAwIhMkGQ68wpj_xj_gqdg-mgLBx4egK7X1gbLTo-3k. "event" : "removeThreadUserEmailSubscription", ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { { })(LITHIUM.jQuery); ] "context" : "", }, } { "actions" : [ "actions" : [ "linkDisabled" : "false" }, ;(function($) { }, "actions" : [ element.find('li').removeClass('active'); { "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2058758 .lia-rating-control-passive', '#form_2'); { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/StoerungsmeldungenInternetTVTelefon/thread-id/46276","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8Xwbnqxyxc_ds64Lf8wEo9lk197T5YVA6J_PuDyfvjs. $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); } { "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? var resetMenu = function() { }, $(this).toggleClass('active'); "action" : "rerender" Wir zeigen Ihnen die häufigsten Ursachen und deren Lösungen. ', 'ajax'); LITHIUM.Dialog.options['2017907831'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; }, { "context" : "", Antworten D. DunkleSahne90 Neues Mitglied. ] "action" : "rerender" \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, '; } ] "showCountOnly" : "false", ] "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", } "action" : "rerender" ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, ] ] .attr('aria-expanded','true') "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "AcceptSolutionAction", "buttonDialogCloseAlt" : "Schließen", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "kudosLinksDisabled" : "false", ] { "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "envParam:selectedMessage", LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.